Web stats for Craigwatkinscriminaldefenselawyer - craigwatkinscriminaldefenselawyer.com
1.67 Rating by ClearWebStats
craigwatkinscriminaldefenselawyer.com is 8 years 10 months 2 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, craigwatkinscriminaldefenselawyer.com is SAFE to browse.
Traffic Report of Craigwatkinscriminaldefenselawyer
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
86
Siteadvisor Rating
Not Applicable
Where is craigwatkinscriminaldefenselawyer.com server located?
Hosted IP Address:
192.185.193.184
Hosted Country:
US
Location Latitude:
29.8324Location Longitude:
-95.472Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
| H3 Headings: | 3 | H4 Headings: | 3 |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 2 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 192.185.193.184)
National Punctuation Day
National Punctuation Day, September 24, celebrates the importance of proper punctuation.
1,388,281 
$ 480.00
Vios Publicidad - Módulos Publicitarios y estructuras
>Empresa con 30 años de experiencia brinda buen acabado y precios competitivos en sus servicios. Módulos Publicitarios, Estructuras Metálicas, Diseño
Not Applicable $ 8.95
ΕΕΠΙ&ΜΑ | Ελληνική Εταιρεία Πυρηνικής Ιατρικής & Μοριακής Απεικόνισης
6,500,201 $ 8.95
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.8.0
Date: Sun, 19 Jul 2015 16:59:37 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Pingback: http://craigwatkinscriminaldefenselawyer.com/xmlrpc.php
Content-Encoding: gzip
Status-Code: 200
Status: 200 OK
Server: nginx/1.8.0
Date: Sun, 19 Jul 2015 16:59:37 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Pingback: http://craigwatkinscriminaldefenselawyer.com/xmlrpc.php
Content-Encoding: gzip
Domain Information for craigwatkinscriminaldefenselawyer.com
| Domain Registrar: |
GODADDY.COM, LLC
|
|---|---|
| Registration Date: | 2015-06-13 8 years 10 months 2 weeks ago |
| Last Modified: | 2015-06-16 8 years 10 months 1 week ago |
| Expiration Date: | 2020-06-13 3 years 10 months 2 weeks ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns623.websitewelcome.com |
|
192.185.193.160 |
United States
|
| ns624.websitewelcome.com |
|
192.185.193.161 |
United States
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| craigwatkinscriminaldefenselawyer.com | A | 14393 |
IP:192.185.193.184 |
| craigwatkinscriminaldefenselawyer.com | NS | 21599 |
Target:ns624.websitewelcome.com |
| craigwatkinscriminaldefenselawyer.com | NS | 21599 |
Target:ns623.websitewelcome.com |
| craigwatkinscriminaldefenselawyer.com | SOA | 21599 |
MNAME:ns623.websitewelcome.com RNAME:everett.mup2.com Serial:2015070203 Refresh:86400 Retry:7200 Expire:3600000 |
| craigwatkinscriminaldefenselawyer.com | MX | 14399 |
Target:craigwatkinscriminaldefenselawyer.com |
| craigwatkinscriminaldefenselawyer.com | TXT | 14399 |
TXT:v=spf1 a mx include:websitewelcome.com ~all |
Similarly Ranked Websites to Craigwatkinscriminaldefenselawyer
Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.
1 $ 8,833,062,960.00
Google Calendar - Sign in to Access & Edit Your Schedule
Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).
1 $ 8,833,062,960.00
Gmail
Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.
1 $ 8,833,062,960.00
Android Apps on Google Play
Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.
1 $ 8,833,062,960.00
Google Chrome - Download the Fast, Secure Browser from Google
Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.
1 $ 8,833,062,960.00